PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013589290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 201aa    MW: 22651.3 Da    PI: 8.6978
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013589290.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.63e-091762954
                    CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  9 rkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54
                    r   NR +A rs +RK  +i+eLe++v++L++e ++L  +l   + 
  XP_013589290.1 17 RILANRQSAARSKERKARYIQELERRVQSLQTEATTLSAQLTLFQR 62
                    6677*********************************998877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.4E-10973IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.2E-81659No hitNo description
CDDcd147033.93E-171763No hitNo description
PROSITE profilePS502179.6571774IPR004827Basic-leucine zipper domain
PfamPF001703.9E-71762IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.21E-91764No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
KKKINEDFQK LCNLICRILA NRQSAARSKE RKARYIQELE RRVQSLQTEA TTLSAQLTLF  60
QRDTNGLANE NTELKMRLQA MEQQAHLRNA LNEALRKEVE RMKMETGEIS GNSDSFDMGM  120
QQVQYSPSTF MAIPPYNHGS INNGQDMQQM RGFNQMSNSQ SVSEFLQNGR LQGLEISSNN  180
SSSLVKSEGP SLSGSESSSA Y
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013589290.11e-146PREDICTED: transcription factor RF2b-like, partial
SwissprotQ6S4P45e-55RF2B_ORYSJ; Transcription factor RF2b
TrEMBLM4EPE31e-131M4EPE3_BRARP; Uncharacterized protein
STRINGBra030663.1-P1e-131(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135551727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.11e-95basic leucine-zipper 52